Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Methanobacterium thermoautotrophicum
>MTH1592 hypothetical protein MTH1592 
MIDLNIGYVLLCVFIGFLTYYRGALDVWGSLFMILMGLLIILSAGFNWLLLIFIFLVLGLLSTKYRHEYKKELGVFEGTR
SAKNVISNGIVPFIMAAFGYYDGFVGGFIGSVATATADTMASEIGVLQTPRLITTLKRVEPGTDGGISSLGTAAGIAGAG
IIGLSAFLLGVCPDPLKSMKVAVIAGTVGCFMDSLLGAVLERRKYLTNEHVNLLATVTGAVIGIILG

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
__________ GenBank id: 15679587 Gene name: - COG: S COG1836 Predicted membrane protein Taxon: 187420 Lineage: Archaea: Euryarchaeota: Methanobacteria: Methanobacteriales: Methanobacteriaceae: Methanothermobacter: Methanothermobacter thermautotrophicus: Methanothermobacter thermautotrophicus str. Delta H
__________