Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Thermotoga maritima
>TM0078 iron(III) ABC transporter, ATP-binding protein 
MEIVRIENLFFQYRGGFSLKNINLSVKKGEFFGIIGPNGSGKTTLLKILVGIFRPQKGTVQLLGRIPWETSRKEMAKIVT
LVSQDFFPSYDFSVKEIVEMGRLPHLSLLSGTSRKDEEIVLKSLELTGTLKFVDRNFWTLSSGERRKVVLSKAIVQDTEI
LLIDELTAHLDYNNVSLVGNVLKRLKESGKTIISVFHDINVASALCDRIGVMKNGEMIKTGAPPEVVTEEVLRNTFETEF
VVLEHPVTGRPLAFLK

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
__________ GenBank id: 15642853 Gene name: - COG: PH COG1120 ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components Taxon: 243274 Lineage: Bacteria: Thermotogae: Thermotogae: Thermotogales: Thermotogaceae: Thermotoga: Thermotoga maritima: Thermotoga maritima MSB8
__________