Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Thermotoga maritima
>TM0159 ham1 protein 
MKKLTVYLATTNPHKVEEIKMIAPEWMEILPSPEKIEVVEDGETFLENSVKKAVVYGKKLKHPVMADDSGLVIYSLGGFP
GVMSARFMEEHSYKEKMRTILKMLEGKDRRAAFVCSATFFDPVENTLISVEDRVEGRIANEIRGTGGFGYDPFFIPDGYD
KTFGEIPHLKEKISHRSKAFRKLFSVLEKILESENR

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
__________ GenBank id: 15642933 Gene name: - COG: F COG0127 Xanthosine triphosphate pyrophosphatase Taxon: 243274 Lineage: Bacteria: Thermotogae: Thermotogae: Thermotogales: Thermotogaceae: Thermotoga: Thermotoga maritima: Thermotoga maritima MSB8
__________