Genomapper BLAST  psiBLAST  Mulalbla  Multalin  Genes & Genomes  BLAST (restricted)  Genome Guts  COG Guess  INTERPROScan  CDD search  Pattern search  Sequence Patterns  COG Trees  Genome Syntenizer
Kluyveromyces lactis Chromosome V
>r_klactV0739 Similar to YOR130c SP|Q12375 ARG11 ornithine transport protein of mitochondria involved in arginine metabolism, member of the mitochondrial carrier family (MCF) {P33.2.f4.2}
MSDLESALKDIAYGSVAGAIGKVIEYPFDTVKVRLQTQPAHLYPTTWSCIRSTYTDEGIWKGFYQGIASPLFGAALENAV
LFVSFNQCTNFLDEFTQLKPLTKTIYSGAFAGACASFILTPVELVKCKLQVSNISNSLSQTTRHTSVWPTIKSVIKEKGL
LGLWQGQLSTFVRECLGGAVWFTTYEIMKMKFASLHPAEKENHTWELLVSGASAGVLFNASVFPADTVKSVCQTEHVSIV
NALKKVLRTHGITGFYRGLGITLIRAAPANATVFYTYETLKKMF

Supplementary options
Additional orf sequence data See Genomic Environment
Search GenBank with PSI-Blast at NCBI Search Complete Genomes DataBase with Blast at LBMGE
Search InterPro Database at LBMGE Search CDD Database at LBMGE
Determine COG functional Category (microbial) Determine COG functional Category (eukarial)
__________ GenBank id: 100000066242 Gene name: - COG: Taxon: 284590 Lineage: Eukaryota: Opisthokonta: Fungi: Dikarya: Ascomycota: saccharomyceta: Saccharomycotina: Saccharomycetes: Saccharomycetales: Saccharomycetaceae: Kluyveromyces: Kluyveromyces lactis: Kluyveromyces lactis NRRL Y-1140
__________